PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G02590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 299aa    MW: 32816 Da    PI: 9.9313
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G02590.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding301.2e-092873347
                     SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqky 47
                     +W++eE +++ +a + l  +  +W+++ar ++ gR++ ++ ++++++
  OMERI01G02590.1 28 KWSPEENKQFERALAGLDLRcpDWDRVARAIP-GRSALEVMNHFRDL 73
                     8*****************99************.***********976 PP

2Myb_DNA-binding48.12.7e-15146190347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  OMERI01G02590.1 146 PWTEEEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 190
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.5E-52576IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-42772IPR009057Homeodomain-like
PROSITE profilePS500906.2842874IPR017877Myb-like domain
CDDcd001671.17E-72873No hitNo description
PfamPF002493.9E-82873IPR001005SANT/Myb domain
SuperFamilySSF466893.07E-82881IPR009057Homeodomain-like
PROSITE profilePS5129418.359139195IPR017930Myb domain
SuperFamilySSF466896.42E-18140195IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-17142193IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.4E-12143189IPR009057Homeodomain-like
SMARTSM007173.4E-13143193IPR001005SANT/Myb domain
PfamPF002491.0E-12146190IPR001005SANT/Myb domain
CDDcd001678.16E-12146191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MMMRDVCMEV LPPMDHYASR GNWFMARKWS PEENKQFERA LAGLDLRCPD WDRVARAIPG  60
RSALEVMNHF RDLELDVQQI ENGMVPFPVY GAAAAAAAAG GAFTLQWDGA HGVGDFRNAY  120
RFGGGGGGGK RHFGRTPEQE RKKGVPWTEE EHKLFLLGLK KYGKGDWRNI SRNFVQTRTP  180
TQVASHAQKY FIRLNSGGKD KRRSSIHDIT TVNLTDDRPP SPSQSSLISN QSNTSTLTAA  240
VAPFSSTADV KPKNAANASF SSPSRTLGMA GYGMGLQDQG LQCGGPLHDQ LAASRSILF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-131890373RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679640.0AK067964.1 Oryza sativa Japonica Group cDNA clone:J013124L02, full insert sequence.
GenBankEU8372500.0EU837250.1 Oryza sativa Japonica Group clone KCB707G04 myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621817.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H77e-83DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0E0BWY90.0A0A0E0BWY9_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g04930.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.13e-61MYB family protein